Reaction SMILES-AA mapping via language modelling

Related tags

Deep Learningrxnaamapper
Overview

rxn-aa-mapper

Reactions SMILES-AA sequence mapping

setup

conda env create -f conda.yml
conda activate rxn_aa_mapper

In the following we consider on examples provided to show how to use RXNAAMapper.

generate a vocabulary to be used with the EnzymaticReactionBertTokenizer

Create a vocabulary compatible with the enzymatic reaction tokenizer:

create-enzymatic-reaction-vocabulary ./examples/data-samples/biochemical ./examples/token_75K_min_600_max_750_500K.json /tmp/vocabulary.txt "*.csv"

use the tokenizer

Using the examples vocabulary and AA tokenizer provided, we can observe the enzymatic reaction tokenizer in action:

from rxn_aa_mapper.tokenization import EnzymaticReactionBertTokenizer

tokenizer = EnzymaticReactionBertTokenizer(
    vocabulary_file="./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    aa_sequence_tokenizer_filepath="./examples/token_75K_min_600_max_750_500K.json"
)
tokenizer.tokenize("NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]")

train the model

The mlm-trainer script can be used to train a model via MTL:

mlm-trainer \
    ./examples/data-samples/biochemical ./examples/data-samples/biochemical \  # just a sample, simply split data in a train and a validation folder
    ./examples/vocabulary_token_75K_min_600_max_750_500K.txt /tmp/mlm-trainer-log \
    ./examples/sample-config.json "*.csv" 1 \  # for a more realistic config see ./examples/config.json
    ./examples/data-samples/organic ./examples/data-samples/organic \  # just a sample, simply split data in a train and a validation folder
    ./examples/token_75K_min_600_max_750_500K.json

Checkpoints will be stored in the /tmp/mlm-trainer-log for later usage in identification of active sites.

Those can be turned into an HuggingFace model by simply running:

checkpoint-to-hf-model /path/to/model.ckpt /tmp/rxnaamapper-pretrained-model ./examples/vocabulary_token_75K_min_600_max_750_500K.txt ./examples/sample-config.json ./examples/token_75K_min_600_max_750_500K.json

predict active site

The trained model can used to map reactant atoms to AA sequence locations that potentially represent the active site.

from rxn_aa_mapper.aa_mapper import RXNAAMapper

config_mapper = {
    "vocabulary_file": "./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    "aa_sequence_tokenizer_filepath": "./examples/token_75K_min_600_max_750_500K.json",
    "model_path": "/tmp/rxnaamapper-pretrained-model",
    "head": 3,
    "layers": [11],
    "top_k": 1,
}
mapper = RXNAAMapper(config=config_mapper)
mapper.get_reactant_aa_sequence_attention_guided_maps(["NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]"])

citation

@article{dassi2021identification,
  title={Identification of Enzymatic Active Sites with Unsupervised Language Modeling},
  author={Dassi, Lo{\"\i}c Kwate and Manica, Matteo and Probst, Daniel and Schwaller, Philippe and Teukam, Yves Gaetan Nana and Laino, Teodoro},
  year={2021}
  conference={AI for Science: Mind the Gaps at NeurIPS 2021, ELLIS Machine Learning for Molecule Discovery Workshop 2021}
}
Owner
GitHub Repository
Official source code of paper 'IterMVS: Iterative Probability Estimation for Efficient Multi-View Stereo'

IterMVS official source code of paper 'IterMVS: Iterative Probability Estimation for Efficient Multi-View Stereo' Introduction IterMVS is a novel lear

Fangjinhua Wang 127 Jan 04, 2023
End-to-end Temporal Action Detection with Transformer. [Under review]

TadTR: End-to-end Temporal Action Detection with Transformer By Xiaolong Liu, Qimeng Wang, Yao Hu, Xu Tang, Song Bai, Xiang Bai. This repo holds the c

Xiaolong Liu 105 Dec 25, 2022
Racing line optimization algorithm in python that uses Particle Swarm Optimization.

Racing Line Optimization with PSO This repository contains a racing line optimization algorithm in python that uses Particle Swarm Optimization. Requi

Parsa Dahesh 6 Dec 14, 2022
Monocular Depth Estimation Using Laplacian Pyramid-Based Depth Residuals

LapDepth-release This repository is a Pytorch implementation of the paper "Monocular Depth Estimation Using Laplacian Pyramid-Based Depth Residuals" M

Minsoo Song 205 Dec 30, 2022
PyTorch implementation of Train Short, Test Long: Attention with Linear Biases Enables Input Length Extrapolation.

ALiBi PyTorch implementation of Train Short, Test Long: Attention with Linear Biases Enables Input Length Extrapolation. Quickstart Clone this reposit

Jake Tae 4 Jul 27, 2022
DABO: Data Augmentation with Bilevel Optimization

DABO: Data Augmentation with Bilevel Optimization [Paper] The goal is to automatically learn an efficient data augmentation regime for image classific

ElementAI 24 Aug 12, 2022
A Lighting Pytorch Framework for Recommendation System, Easy-to-use and Easy-to-extend.

Torch-RecHub A Lighting Pytorch Framework for Recommendation Models, Easy-to-use and Easy-to-extend. 安装 pip install torch-rechub 主要特性 scikit-learn风格易用

Mincai Lai 67 Jan 04, 2023
OCR Post Correction for Endangered Language Texts

📌 Coming soon: an update to the software including features from our paper on semi-supervised OCR post-correction, to be published in the Transaction

Shruti Rijhwani 96 Dec 31, 2022
[ICCV 2021 Oral] Just Ask: Learning to Answer Questions from Millions of Narrated Videos

Just Ask: Learning to Answer Questions from Millions of Narrated Videos Webpage • Demo • Paper This repository provides the code for our paper, includ

Antoine Yang 87 Jan 05, 2023
Tensorflow Implementation for "Pre-trained Deep Convolution Neural Network Model With Attention for Speech Emotion Recognition"

Tensorflow Implementation for "Pre-trained Deep Convolution Neural Network Model With Attention for Speech Emotion Recognition" Pre-trained Deep Convo

Ankush Malaker 5 Nov 11, 2022
Range Image-based LiDAR Localization for Autonomous Vehicles Using Mesh Maps

Range Image-based 3D LiDAR Localization This repo contains the code for our ICRA2021 paper: Range Image-based LiDAR Localization for Autonomous Vehicl

Photogrammetry & Robotics Bonn 208 Dec 15, 2022
Towards Debiasing NLU Models from Unknown Biases

Towards Debiasing NLU Models from Unknown Biases Abstract: NLU models often exploit biased features to achieve high dataset-specific performance witho

Ubiquitous Knowledge Processing Lab 22 Jun 14, 2022
A pytorch &keras implementation and demo of Fastformer.

Fastformer Notes from the authors Pytorch/Keras implementation of Fastformer. The keras version only includes the core fastformer attention part. The

153 Dec 28, 2022
DeepDiffusion: Unsupervised Learning of Retrieval-adapted Representations via Diffusion-based Ranking on Latent Feature Manifold

DeepDiffusion Introduction This repository provides the code of the DeepDiffusion algorithm for unsupervised learning of retrieval-adapted representat

4 Nov 15, 2022
Cerberus Transformer: Joint Semantic, Affordance and Attribute Parsing

Cerberus Transformer: Joint Semantic, Affordance and Attribute Parsing Paper Introduction Multi-task indoor scene understanding is widely considered a

62 Dec 05, 2022
The code for SAG-DTA: Prediction of Drug–Target Affinity Using Self-Attention Graph Network.

SAG-DTA The code is the implementation for the paper 'SAG-DTA: Prediction of Drug–Target Affinity Using Self-Attention Graph Network'. Requirements py

Shugang Zhang 7 Aug 02, 2022
Final project for Intro to CS class.

Financial Analysis Web App https://share.streamlit.io/mayurk1/fin-web-app-final-project/webApp.py 1. Project Description This project is a technical a

Mayur Khanna 1 Dec 10, 2021
Reinforcement-learning - Repository of the class assignment questions for the course on reinforcement learning

DSE 314/614: Reinforcement Learning This repository containing reinforcement lea

Manav Mishra 4 Apr 15, 2022
OBBDetection: an oriented object detection toolbox modified from MMdetection

OBBDetection note: If you have questions or good suggestions, feel free to propose issues and contact me. introduction OBBDetection is an oriented obj

MIXIAOXIN_HO 3 Nov 11, 2022
Repository to run object detection on a model trained on an autonomous driving dataset.

Autonomous Driving Object Detection on the Raspberry Pi 4 Description of Repository This repository contains code and instructions to configure the ne

Ethan 51 Nov 17, 2022