Reaction SMILES-AA mapping via language modelling

Related tags

Deep Learningrxnaamapper
Overview

rxn-aa-mapper

Reactions SMILES-AA sequence mapping

setup

conda env create -f conda.yml
conda activate rxn_aa_mapper

In the following we consider on examples provided to show how to use RXNAAMapper.

generate a vocabulary to be used with the EnzymaticReactionBertTokenizer

Create a vocabulary compatible with the enzymatic reaction tokenizer:

create-enzymatic-reaction-vocabulary ./examples/data-samples/biochemical ./examples/token_75K_min_600_max_750_500K.json /tmp/vocabulary.txt "*.csv"

use the tokenizer

Using the examples vocabulary and AA tokenizer provided, we can observe the enzymatic reaction tokenizer in action:

from rxn_aa_mapper.tokenization import EnzymaticReactionBertTokenizer

tokenizer = EnzymaticReactionBertTokenizer(
    vocabulary_file="./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    aa_sequence_tokenizer_filepath="./examples/token_75K_min_600_max_750_500K.json"
)
tokenizer.tokenize("NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]")

train the model

The mlm-trainer script can be used to train a model via MTL:

mlm-trainer \
    ./examples/data-samples/biochemical ./examples/data-samples/biochemical \  # just a sample, simply split data in a train and a validation folder
    ./examples/vocabulary_token_75K_min_600_max_750_500K.txt /tmp/mlm-trainer-log \
    ./examples/sample-config.json "*.csv" 1 \  # for a more realistic config see ./examples/config.json
    ./examples/data-samples/organic ./examples/data-samples/organic \  # just a sample, simply split data in a train and a validation folder
    ./examples/token_75K_min_600_max_750_500K.json

Checkpoints will be stored in the /tmp/mlm-trainer-log for later usage in identification of active sites.

Those can be turned into an HuggingFace model by simply running:

checkpoint-to-hf-model /path/to/model.ckpt /tmp/rxnaamapper-pretrained-model ./examples/vocabulary_token_75K_min_600_max_750_500K.txt ./examples/sample-config.json ./examples/token_75K_min_600_max_750_500K.json

predict active site

The trained model can used to map reactant atoms to AA sequence locations that potentially represent the active site.

from rxn_aa_mapper.aa_mapper import RXNAAMapper

config_mapper = {
    "vocabulary_file": "./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    "aa_sequence_tokenizer_filepath": "./examples/token_75K_min_600_max_750_500K.json",
    "model_path": "/tmp/rxnaamapper-pretrained-model",
    "head": 3,
    "layers": [11],
    "top_k": 1,
}
mapper = RXNAAMapper(config=config_mapper)
mapper.get_reactant_aa_sequence_attention_guided_maps(["NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]"])

citation

@article{dassi2021identification,
  title={Identification of Enzymatic Active Sites with Unsupervised Language Modeling},
  author={Dassi, Lo{\"\i}c Kwate and Manica, Matteo and Probst, Daniel and Schwaller, Philippe and Teukam, Yves Gaetan Nana and Laino, Teodoro},
  year={2021}
  conference={AI for Science: Mind the Gaps at NeurIPS 2021, ELLIS Machine Learning for Molecule Discovery Workshop 2021}
}
Owner
GitHub Repository
Fast, general, and tested differentiable structured prediction in PyTorch

Fast, general, and tested differentiable structured prediction in PyTorch

HNLP 1.1k Dec 16, 2022
Use .csv files to record, play and evaluate motion capture data.

Purpose These scripts allow you to record mocap data to, and play from .csv files. This approach facilitates parsing of body movement data in statisti

21 Dec 12, 2022
Transformer in Computer Vision

Transformer-in-Vision A paper list of some recent Transformer-based CV works. If you find some ignored papers, please open issues or pull requests. **

506 Dec 26, 2022
Open-source python package for the extraction of Radiomics features from 2D and 3D images and binary masks.

pyradiomics v3.0.1 Build Status Linux macOS Windows Radiomics feature extraction in Python This is an open-source python package for the extraction of

Artificial Intelligence in Medicine (AIM) Program 842 Dec 28, 2022
Demonstration of the Model Training as a CI/CD System in Vertex AI

Model Training as a CI/CD System This project demonstrates the machine model training as a CI/CD system in GCP platform. You will see more detailed wo

Chansung Park 19 Dec 28, 2022
This repository provides some of the code implemented and the data used for the work proposed in "A Cluster-Based Trip Prediction Graph Neural Network Model for Bike Sharing Systems".

cluster-link-prediction This repository provides some of the code implemented and the data used for the work proposed in "A Cluster-Based Trip Predict

Bárbara 0 Dec 28, 2022
PyTorch implementation of "A Full-Band and Sub-Band Fusion Model for Real-Time Single-Channel Speech Enhancement."

FullSubNet This Git repository for the official PyTorch implementation of "A Full-Band and Sub-Band Fusion Model for Real-Time Single-Channel Speech E

郝翔 357 Jan 04, 2023
Using deep learning to predict gene structures of the coding genes in DNA sequences of Arabidopsis thaliana

DeepGeneAnnotator: A tool to annotate the gene in the genome The master thesis of the "Using deep learning to predict gene structures of the coding ge

Ching-Tien Wang 3 Sep 09, 2022
PyTorch implementation of "Continual Learning with Deep Generative Replay", NIPS 2017

pytorch-deep-generative-replay PyTorch implementation of Continual Learning with Deep Generative Replay, NIPS 2017 Results Continual Learning on Permu

Junsoo Ha 127 Dec 14, 2022
Mixed Transformer UNet for Medical Image Segmentation

MT-UNet Update 2022/01/05 By another round of training based on previous weights, our model also achieved a better performance on ACDC (91.61% DSC). W

dotman 92 Dec 25, 2022
On-device speech-to-index engine powered by deep learning.

On-device speech-to-index engine powered by deep learning.

Picovoice 30 Nov 24, 2022
The code for the NeurIPS 2021 paper "A Unified View of cGANs with and without Classifiers".

Energy-based Conditional Generative Adversarial Network (ECGAN) This is the code for the NeurIPS 2021 paper "A Unified View of cGANs with and without

sianchen 22 May 28, 2022
FasterAI: A library to make smaller and faster models with FastAI.

Fasterai fasterai is a library created to make neural network smaller and faster. It essentially relies on common compression techniques for networks

Nathan Hubens 193 Jan 01, 2023
OpenFed: A Comprehensive and Versatile Open-Source Federated Learning Framework

OpenFed: A Comprehensive and Versatile Open-Source Federated Learning Framework Introduction OpenFed is a foundational library for federated learning

25 Dec 12, 2022
Improving Factual Consistency of Abstractive Text Summarization

Improving Factual Consistency of Abstractive Text Summarization We provide the code for the papers: "Entity-level Factual Consistency of Abstractive T

61 Nov 27, 2022
Joint Discriminative and Generative Learning for Person Re-identification. CVPR'19 (Oral)

Joint Discriminative and Generative Learning for Person Re-identification [Project] [Paper] [YouTube] [Bilibili] [Poster] [Supp] Joint Discriminative

NVIDIA Research Projects 1.2k Dec 30, 2022
BASH - Biomechanical Animated Skinned Human

We developed a method animating a statistical 3D human model for biomechanical analysis to increase accessibility for non-experts, like patients, athletes, or designers.

Machine Learning and Data Analytics Lab FAU 66 Nov 19, 2022
Code for the paper "Next Generation Reservoir Computing"

Next Generation Reservoir Computing This is the code for the results and figures in our paper "Next Generation Reservoir Computing". They are written

OSU QuantInfo Lab 105 Dec 20, 2022
This is the repository of our article published on MDPI Entropy "Feature Selection for Recommender Systems with Quantum Computing".

Collaborative-driven Quantum Feature Selection This repository was developed by Riccardo Nembrini, PhD student at Politecnico di Milano. See the websi

Quantum Computing Lab @ Politecnico di Milano 10 Apr 21, 2022
A collection of educational notebooks on multi-view geometry and computer vision.

Multiview notebooks This is a collection of educational notebooks on multi-view geometry and computer vision. Subjects covered in these notebooks incl

Max 65 Dec 09, 2022