Reaction SMILES-AA mapping via language modelling

Related tags

Deep Learningrxnaamapper
Overview

rxn-aa-mapper

Reactions SMILES-AA sequence mapping

setup

conda env create -f conda.yml
conda activate rxn_aa_mapper

In the following we consider on examples provided to show how to use RXNAAMapper.

generate a vocabulary to be used with the EnzymaticReactionBertTokenizer

Create a vocabulary compatible with the enzymatic reaction tokenizer:

create-enzymatic-reaction-vocabulary ./examples/data-samples/biochemical ./examples/token_75K_min_600_max_750_500K.json /tmp/vocabulary.txt "*.csv"

use the tokenizer

Using the examples vocabulary and AA tokenizer provided, we can observe the enzymatic reaction tokenizer in action:

from rxn_aa_mapper.tokenization import EnzymaticReactionBertTokenizer

tokenizer = EnzymaticReactionBertTokenizer(
    vocabulary_file="./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    aa_sequence_tokenizer_filepath="./examples/token_75K_min_600_max_750_500K.json"
)
tokenizer.tokenize("NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]")

train the model

The mlm-trainer script can be used to train a model via MTL:

mlm-trainer \
    ./examples/data-samples/biochemical ./examples/data-samples/biochemical \  # just a sample, simply split data in a train and a validation folder
    ./examples/vocabulary_token_75K_min_600_max_750_500K.txt /tmp/mlm-trainer-log \
    ./examples/sample-config.json "*.csv" 1 \  # for a more realistic config see ./examples/config.json
    ./examples/data-samples/organic ./examples/data-samples/organic \  # just a sample, simply split data in a train and a validation folder
    ./examples/token_75K_min_600_max_750_500K.json

Checkpoints will be stored in the /tmp/mlm-trainer-log for later usage in identification of active sites.

Those can be turned into an HuggingFace model by simply running:

checkpoint-to-hf-model /path/to/model.ckpt /tmp/rxnaamapper-pretrained-model ./examples/vocabulary_token_75K_min_600_max_750_500K.txt ./examples/sample-config.json ./examples/token_75K_min_600_max_750_500K.json

predict active site

The trained model can used to map reactant atoms to AA sequence locations that potentially represent the active site.

from rxn_aa_mapper.aa_mapper import RXNAAMapper

config_mapper = {
    "vocabulary_file": "./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    "aa_sequence_tokenizer_filepath": "./examples/token_75K_min_600_max_750_500K.json",
    "model_path": "/tmp/rxnaamapper-pretrained-model",
    "head": 3,
    "layers": [11],
    "top_k": 1,
}
mapper = RXNAAMapper(config=config_mapper)
mapper.get_reactant_aa_sequence_attention_guided_maps(["NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]"])

citation

@article{dassi2021identification,
  title={Identification of Enzymatic Active Sites with Unsupervised Language Modeling},
  author={Dassi, Lo{\"\i}c Kwate and Manica, Matteo and Probst, Daniel and Schwaller, Philippe and Teukam, Yves Gaetan Nana and Laino, Teodoro},
  year={2021}
  conference={AI for Science: Mind the Gaps at NeurIPS 2021, ELLIS Machine Learning for Molecule Discovery Workshop 2021}
}
Owner
GitHub Repository
Codebase to experiment with a hybrid Transformer that combines conditional sequence generation with regression

Regression Transformer Codebase to experiment with a hybrid Transformer that combines conditional sequence generation with regression . Development se

International Business Machines 27 Jan 05, 2023
This repository contains small projects related to Neural Networks and Deep Learning in general.

ILearnDeepLearning.py Description People say that nothing develops and teaches you like getting your hands dirty. This repository contains small proje

Piotr Skalski 1.2k Dec 22, 2022
Code and data of the Fine-Grained R2R Dataset proposed in paper Sub-Instruction Aware Vision-and-Language Navigation

Fine-Grained R2R Code and data of the Fine-Grained R2R Dataset proposed in the EMNLP2020 paper Sub-Instruction Aware Vision-and-Language Navigation. C

YicongHong 34 Nov 15, 2022
[CVPR2021 Oral] FFB6D: A Full Flow Bidirectional Fusion Network for 6D Pose Estimation.

FFB6D This is the official source code for the CVPR2021 Oral work, FFB6D: A Full Flow Biderectional Fusion Network for 6D Pose Estimation. (Arxiv) Tab

Yisheng (Ethan) He 201 Dec 28, 2022
Unofficial PyTorch Implementation for HifiFace (https://arxiv.org/abs/2106.09965)

HifiFace — Unofficial Pytorch Implementation Image source: HifiFace: 3D Shape and Semantic Prior Guided High Fidelity Face Swapping (figure 1, pg. 1)

MINDs Lab 218 Jan 04, 2023
Scribble-Supervised LiDAR Semantic Segmentation, CVPR 2022 (ORAL)

Scribble-Supervised LiDAR Semantic Segmentation Dataset and code release for the paper Scribble-Supervised LiDAR Semantic Segmentation, CVPR 2022 (ORA

102 Dec 25, 2022
An open source Jetson Nano baseboard and tools to design your own.

My Jetson Nano Baseboard This basic baseboard gives the user the foundation and the flexibility to design their own baseboard for the Jetson Nano. It

NVIDIA AI IOT 57 Dec 29, 2022
Lightweight Salient Object Detection in Optical Remote Sensing Images via Feature Correlation

CorrNet This project provides the code and results for 'Lightweight Salient Object Detection in Optical Remote Sensing Images via Feature Correlation'

Gongyang Li 13 Nov 03, 2022
Multi-atlas segmentation (MAS) is a promising framework for medical image segmentation

Multi-atlas segmentation (MAS) is a promising framework for medical image segmentation. Generally, MAS methods register multiple atlases, i.e., medical images with corresponding labels, to a target i

NanYoMy 13 Oct 09, 2022
MultiLexNorm 2021 competition system from ÚFAL

ÚFAL at MultiLexNorm 2021: Improving Multilingual Lexical Normalization by Fine-tuning ByT5 David Samuel & Milan Straka Charles University Faculty of

ÚFAL 13 Jun 28, 2022
Adjust Decision Boundary for Class Imbalanced Learning

Adjusting Decision Boundary for Class Imbalanced Learning This repository is the official PyTorch implementation of WVN-RS, introduced in Adjusting De

Peyton Byungju Kim 16 Jan 04, 2023
Data Consistency for Magnetic Resonance Imaging

Data Consistency for Magnetic Resonance Imaging Data Consistency (DC) is crucial for generalization in multi-modal MRI data and robustness in detectin

Dimitris Karkalousos 19 Dec 12, 2022
Python package for dynamic system estimation of time series

PyDSE Toolset for Dynamic System Estimation for time series inspired by DSE. It is in a beta state and only includes ARMA models right now. Documentat

Blue Yonder GmbH 40 Oct 07, 2022
BC3407-Group-5-Project - BC3407 Group Project With Python

BC3407-Group-5-Project As the world struggles to contain the ever-changing varia

1 Jan 26, 2022
ICLR 2021: Pre-Training for Context Representation in Conversational Semantic Parsing

SCoRe: Pre-Training for Context Representation in Conversational Semantic Parsing This repository contains code for the ICLR 2021 paper "SCoRE: Pre-Tr

Microsoft 28 Oct 02, 2022
ESPNet: Efficient Spatial Pyramid of Dilated Convolutions for Semantic Segmentation

ESPNet: Efficient Spatial Pyramid of Dilated Convolutions for Semantic Segmentation This repository contains the source code of our paper, ESPNet (acc

Sachin Mehta 515 Dec 13, 2022
Code accompanying paper: Meta-Learning to Improve Pre-Training

Meta-Learning to Improve Pre-Training This folder contains code to run experiments in the paper Meta-Learning to Improve Pre-Training, NeurIPS 2021. P

28 Dec 31, 2022
MVS2D: Efficient Multi-view Stereo via Attention-Driven 2D Convolutions

MVS2D: Efficient Multi-view Stereo via Attention-Driven 2D Convolutions Project Page | Paper If you find our work useful for your research, please con

96 Jan 04, 2023
Streamlit app demonstrating an image browser for the Udacity self-driving-car dataset with realtime object detection using YOLO.

Streamlit Demo: The Udacity Self-driving Car Image Browser This project demonstrates the Udacity self-driving-car dataset and YOLO object detection in

Streamlit 992 Jan 04, 2023
《Towards High Fidelity Face Relighting with Realistic Shadows》(CVPR 2021)

Towards High Fidelity Face-Relighting with Realistic Shadows Andrew Hou, Ze Zhang, Michel Sarkis, Ning Bi, Yiying Tong, Xiaoming Liu. In CVPR, 2021. T

114 Dec 10, 2022