peptides.py is a pure-Python package to compute common descriptors for protein sequences

Last update: Dec 31, 2022

Related tags

Overview

`peptides.py`

Physicochemical properties and indices for amino-acid sequences.

🗺️ Overview

peptides.py is a pure-Python package to compute common descriptors for protein sequences. It is a port of Peptides, the R package written by Daniel Osorio for the same purpose. This library has no external dependency and is available for all modern Python versions (3.6+).

🔧 Installing

Install the peptides package directly from PyPi which hosts universal wheels that can be installed with pip:

$ pip install peptides

💡 Example

Start by creating a Peptide object from a protein sequence:

>>> import peptides
>>> peptide = peptides.Peptide("MLKKRFLGALAVATLLTLSFGTPVMAQSGSAVFTNEGVTPFAISYPGGGT")

Then use the appropriate methods to compute the descriptors you want:

>>> peptide.aliphatic_index()
89.8...
>>> peptide.boman()
-0.2097...
>>> peptide.charge(pH=7.4)
1.99199...
>>> peptide.isoelectric_point()
10.2436...

Methods that return more than one scalar value (for instance, Peptide.blosum_indices) will return a dedicated named tuple:

>>> peptide.ms_whim_scores()
MSWHIMScores(mswhim1=-0.436399..., mswhim2=0.4916..., mswhim3=-0.49200...)

Use the Peptide.descriptors method to get a dictionary with every available descriptor. This makes it very easy to create a pandas.DataFrame with descriptors for several protein sequences:

>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ]) >>> df BLOSUM1 BLOSUM2 BLOSUM3 BLOSUM4 ... Z2 Z3 Z4 Z5 0 0.367000 -0.436000 -0.239 0.014500 ... -0.711000 -0.104500 -1.486500 0.429500 1 -0.697500 -0.372500 -0.493 0.157000 ... -0.307500 -0.627500 -0.450500 0.362000 2 0.479333 -0.001333 0.138 0.228667 ... -0.299333 0.465333 -0.976667 0.023333 [3 rows x 66 columns] ">

>>> seqs = ["SDKEVDEVDAALSDLEITLE", "ARQQNLFINFCLILIFLLLI", "EGVNDNECEGFFSAR"]
>>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ])
>>> df
    BLOSUM1   BLOSUM2  BLOSUM3   BLOSUM4  ...        Z2        Z3        Z4        Z5
0  0.367000 -0.436000   -0.239  0.014500  ... -0.711000 -0.104500 -1.486500  0.429500
1 -0.697500 -0.372500   -0.493  0.157000  ... -0.307500 -0.627500 -0.450500  0.362000
2  0.479333 -0.001333    0.138  0.228667  ... -0.299333  0.465333 -0.976667  0.023333

[3 rows x 66 columns]

💭 Feedback

⚠️ Issue Tracker

Found a bug ? Have an enhancement request ? Head over to the GitHub issue tracker if you need to report or ask something. If you are filing in on a bug, please include as much information as you can about the issue, and try to recreate the same bug in a simple, easily reproducible situation.

🏗️ Contributing

Contributions are more than welcome! See CONTRIBUTING.md for more details.

⚖️ License

This library is provided under the GNU General Public License v3.0. The original R Peptides package was written by Daniel Osorio, Paola Rondón-Villarreal and Rodrigo Torres, and is licensed under the terms of the GPLv2.

This project is in no way not affiliated, sponsored, or otherwise endorsed by the original Peptides authors. It was developed by Martin Larralde during his PhD project at the European Molecular Biology Laboratory in the Zeller team.

You might also like...

Python Package for DataHerb: create, search, and load datasets.

The Python Package for DataHerb A DataHerb Core Service to Create and Load Datasets.

4 Feb 11, 2022

wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information

Python based Wikidata framework for easy dataframe extraction wikirepo is a Python package that provides a framework to easily source and leverage sta

35 Jan 4, 2023

Python package for processing UC module spectral data.

UC Module Python Package How To Install clone repo. cd UC-module pip install . How to Use uc.module.UC(measurment=str, dark=str, reference=str, heade

1 Oct 20, 2021

sportsdataverse python package

sportsdataverse-py See CHANGELOG.md for details. The goal of sportsdataverse-py is to provide the community with a python package for working with spo

37 Dec 27, 2022

PyEmits, a python package for easy manipulation in time-series data.

PyEmits, a python package for easy manipulation in time-series data. Time-series data is very common in real life. Engineering FSI industry (Financial

5 Sep 23, 2022

Retail-Sim is python package to easily create synthetic dataset of retaile store.

Retailer's Sale Data Simulation Retail-Sim is python package to easily create synthetic dataset of retaile store. Simulation Model Simulator consists

7 Sep 30, 2022

A python package which can be pip installed to perform statistics and visualize binomial and gaussian distributions of the dataset

GBiStat package A python package to assist programmers with data analysis. This package could be used to plot : Binomial Distribution of the dataset p

4 Oct 17, 2022

VevestaX is an open source Python package for ML Engineers and Data Scientists.

VevestaX Track failed and successful experiments as well as features. VevestaX is an open source Python package for ML Engineers and Data Scientists.

24 Dec 14, 2022

nrgpy is the Python package for processing NRG Data Files

nrgpy nrgpy is the Python package for processing NRG Data Files Website and source: https://github.com/nrgpy/nrgpy Documentation: https://nrgpy.github

23 Dec 8, 2022

Comments

Per-residue data

It seems that the API can only output single statistics for the entire peptide chain, but I'm interested in statistics for each residue individually. I'm wondering if it might be possible to output an array/list from some of these functions instead of always averaging them as is done now.
enhancement

opened by multimeric 1

Hydrophobic moment is inconsistent with R version

Computed hydrophobic moment is not the same as the one computed by R. More specifically, it seems that peptides.py always outputs 0 for the hydrophobic moment when peptide length is shorter than the set window. The returned value matches the value from R when peptide length is equal to or greater than the set window length.

Example in python:

>>> import peptides`
>>> peptides.Peptide("MLK").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("AACQ").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("FGGIQ").hydrophobic_moment(window=5, angle=100)
0.31847187610377536

Example in R:

> library(Peptides)
> hmoment(seq="MLK", window=5, angle=100)
[1] 0.8099386
> hmoment(seq="AACQ", window=5, angle=100)
[1] 0.3152961
> hmoment(seq="FGGIQ", window=5, angle=100)
[1] 0.3184719

I think that it can be easily fixed by internally setting the window length to the length of the peptide if the latter is shorter. What I propose:

--- a/peptides/__init__.py
+++ b/peptides/__init__.py
@@ -657,6 +657,7 @@ class Peptide(typing.Sequence[str]):
               :doi:`10.1073/pnas.81.1.140`. :pmid:`6582470`.

         """
+        window = min(window, len(self))
         scale = tables.HYDROPHOBICITY["Eisenberg"]
         lut = [scale.get(aa, 0.0) for aa in self._CODE1]
         angles = [(angle * i) % 360 for i in range(window)]

bug

opened by eotovic 1

RuntimeWarning in auto_correlation function()
Hi, thank you for creating peptides.py.

Some hydrophobicity tables together with certain proteins cause a runtime warning for in the function auto_correlation():

import peptides for hydro in peptides.tables.HYDROPHOBICITY.keys(): print(hydro) table = peptides.tables.HYDROPHOBICITY[hydro] peptides.Peptide('MANTQNISIWWWAR').auto_correlation(table)

Warning (s2 == 0):

RuntimeWarning: invalid value encountered in double_scalars return s1 / s2

The tables concerned are: octanolScale_pH2, interfaceScale_pH2, oiScale_pH2 Some other proteins causing the same warning: ['MSYGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGYGY', 'MFILLIIIGASCFGGGGGCGYGGYGGYAGGYGGYCC', 'MSFGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGGF']
opened by jhahnfeld 0

Releases(v0.3.1)

v0.3.1(Sep 1, 2022)
Fixed

peptides.datasets data files missing from the source distribution.

Source code(tar.gz)
Source code(zip)
v0.3.0(Sep 1, 2022)
Added

Peptide.linker_preference_profile to build a profile like used in the DomCut method from Suyama & Ohara (2002).

Peptide.profile to build a generic per-residue profile from a data table (#3).

Source code(tar.gz)
Source code(zip)
v0.2.0(Oct 25, 2021)
Added

Peptide.counts method to get the number of occurences of each amino acid in the peptide.

Peptide.frequencies to get the frequencies of each amino acid in the peptide.

Peptide.pcp_descriptors to compute the PCP descriptors from Mathura & Braun (2001).

Peptide.sneath_vectors to compute the descriptors from Sneath (1966).

Hydrophilicity descriptors from Barley (2018).

Peptide.structural_class to predict the structural class of a protein using one of three reference datasets and one of four distance metrics.

Changed

Peptide.aliphatic_index now supports unknown Leu/Ile residue (code J).

Swap order of Peptide.hydrophobic_moment arguments for consistency with profile methods.

Some Peptide functions now support vectorized code using numpy if available.

Source code(tar.gz)
Source code(zip)
v0.1.0(Oct 21, 2021)

Initial release.
Source code(tar.gz)
Source code(zip)

Owner

Martin Larralde

PhD candidate in Bioinformatics, passionate about programming, Pythonista, Rustacean. I write poems, and sometimes they are executable.

GitHub Repository

A tax calculator for stocks and dividends activities.

Revolut Stocks calculator for Bulgarian National Revenue Agency Information Processing and calculating the required information about stock possession

200 Oct 25, 2022

This mini project showcase how to build and debug Apache Spark application using Python

Spark app can't be debugged using normal procedure. This mini project showcase how to build and debug Apache Spark application using Python programming language. There are also options to run Spark a

1 Dec 29, 2021

:truck: Agile Data Preparation Workflows made easy with dask, cudf, dask_cudf and pyspark

To launch a live notebook server to test optimus using binder or Colab, click on one of the following badges: Optimus is the missing framework to prof

1.3k Dec 30, 2022

A library to create multi-page Streamlit applications with ease.

107 Jan 04, 2023

Methylation/modified base calling separated from basecalling.

Remora Methylation/modified base calling separated from basecalling. Remora primarily provides an API to call modified bases for basecaller programs s

72 Jan 05, 2023

Developed for analyzing the covariance for OrcVIO

about This repo is developed for analyzing the covariance for OrcVIO environment setup platform ubuntu 18.04 using conda conda env create --file envir

1 Dec 08, 2021

Randomisation-based inference in Python based on data resampling and permutation.

67 Dec 27, 2022

Supply a wrapper ``StockDataFrame`` based on the ``pandas.DataFrame`` with inline stock statistics/indicators support.

Stock Statistics/Indicators Calculation Helper VERSION: 0.3.2 Introduction Supply a wrapper StockDataFrame based on the pandas.DataFrame with inline s

1.1k Dec 28, 2022

Display the behaviour of a realtime program with a scope or logic analyser.

1. A monitor for realtime MicroPython code This library provides a means of examining the behaviour of a running system. It was initially designed to

17 Dec 05, 2022

First steps with Python in Life Sciences

First steps with Python in Life Sciences This course material is part of the "First Steps with Python in Life Science" three-day course of SIB-trainin

22 Jan 08, 2023

Time ranges with python

timeranges Time ranges. Read the Docs Installation pip timeranges is available on pip: pip install timeranges GitHub You can also install the latest v

2 Sep 01, 2022

WithPipe is a simple utility for functional piping in Python.

A utility for functional piping in Python that allows you to access any function in any scope as a partial.

1 Oct 26, 2021

Python-based Space Physics Environment Data Analysis Software

pySPEDAS pySPEDAS is an implementation of the SPEDAS framework for Python. The Space Physics Environment Data Analysis Software (SPEDAS) framework is

98 Dec 22, 2022

Mortgage-loan-prediction - Show how to perform advanced Analytics and Machine Learning in Python using a full complement of PyData utilities

Mortgage-loan-prediction - Show how to perform advanced Analytics and Machine Learning in Python using a full complement of PyData utilities. This is aimed at those looking to get into the field of D

1 Dec 26, 2021

Desafio 1 ~ Bantotal

Challenge 01 | Bantotal Please read the instructions for the challenge by selecting your preferred language below: Español Português License Copyright

44 Sep 28, 2022

NFCDS Workshop Beginners Guide Bioinformatics Data Analysis

Genomics Workshop FIXME: overview of workshop Code of Conduct All participants s

2 Jun 13, 2022

Data collection, enhancement, and metrics calculation.

l3_data_collection Data collection, enhancement, and metrics calculation. Summary Repository containing code for QuantDAO's JDT data collection task.

3 Dec 23, 2022

t-SNE and hierarchical clustering are popular methods of exploratory data analysis, particularly in biology.

tree-SNE t-SNE and hierarchical clustering are popular methods of exploratory data analysis, particularly in biology. Building on recent advances in s

61 Nov 21, 2022

GWpy is a collaboration-driven Python package providing tools for studying data from ground-based gravitational-wave detectors

GWpy is a collaboration-driven Python package providing tools for studying data from ground-based gravitational-wave detectors. GWpy provides a user-f

342 Jan 07, 2023

Stream-Kafka-ELK-Stack - Weather data streaming using Apache Kafka and Elastic Stack.

Streaming Data Pipeline - Kafka + ELK Stack Streaming weather data using Apache Kafka and Elastic Stack. Data source: https://openweathermap.org/api O

2 Jan 20, 2022