peptides.py is a pure-Python package to compute common descriptors for protein sequences

Overview

peptides.py Stars

Physicochemical properties and indices for amino-acid sequences.

Actions Coverage PyPI Wheel Python Versions Python Implementations License Source Mirror GitHub issues Changelog Downloads

🗺️ Overview

peptides.py is a pure-Python package to compute common descriptors for protein sequences. It is a port of Peptides, the R package written by Daniel Osorio for the same purpose. This library has no external dependency and is available for all modern Python versions (3.6+).

🔧 Installing

Install the peptides package directly from PyPi which hosts universal wheels that can be installed with pip:

$ pip install peptides

💡 Example

Start by creating a Peptide object from a protein sequence:

>>> import peptides
>>> peptide = peptides.Peptide("MLKKRFLGALAVATLLTLSFGTPVMAQSGSAVFTNEGVTPFAISYPGGGT")

Then use the appropriate methods to compute the descriptors you want:

>>> peptide.aliphatic_index()
89.8...
>>> peptide.boman()
-0.2097...
>>> peptide.charge(pH=7.4)
1.99199...
>>> peptide.isoelectric_point()
10.2436...

Methods that return more than one scalar value (for instance, Peptide.blosum_indices) will return a dedicated named tuple:

>>> peptide.ms_whim_scores()
MSWHIMScores(mswhim1=-0.436399..., mswhim2=0.4916..., mswhim3=-0.49200...)

Use the Peptide.descriptors method to get a dictionary with every available descriptor. This makes it very easy to create a pandas.DataFrame with descriptors for several protein sequences:

>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ]) >>> df BLOSUM1 BLOSUM2 BLOSUM3 BLOSUM4 ... Z2 Z3 Z4 Z5 0 0.367000 -0.436000 -0.239 0.014500 ... -0.711000 -0.104500 -1.486500 0.429500 1 -0.697500 -0.372500 -0.493 0.157000 ... -0.307500 -0.627500 -0.450500 0.362000 2 0.479333 -0.001333 0.138 0.228667 ... -0.299333 0.465333 -0.976667 0.023333 [3 rows x 66 columns] ">
>>> seqs = ["SDKEVDEVDAALSDLEITLE", "ARQQNLFINFCLILIFLLLI", "EGVNDNECEGFFSAR"]
>>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ])
>>> df
    BLOSUM1   BLOSUM2  BLOSUM3   BLOSUM4  ...        Z2        Z3        Z4        Z5
0  0.367000 -0.436000   -0.239  0.014500  ... -0.711000 -0.104500 -1.486500  0.429500
1 -0.697500 -0.372500   -0.493  0.157000  ... -0.307500 -0.627500 -0.450500  0.362000
2  0.479333 -0.001333    0.138  0.228667  ... -0.299333  0.465333 -0.976667  0.023333

[3 rows x 66 columns]

💭 Feedback

⚠️ Issue Tracker

Found a bug ? Have an enhancement request ? Head over to the GitHub issue tracker if you need to report or ask something. If you are filing in on a bug, please include as much information as you can about the issue, and try to recreate the same bug in a simple, easily reproducible situation.

🏗️ Contributing

Contributions are more than welcome! See CONTRIBUTING.md for more details.

⚖️ License

This library is provided under the GNU General Public License v3.0. The original R Peptides package was written by Daniel Osorio, Paola Rondón-Villarreal and Rodrigo Torres, and is licensed under the terms of the GPLv2.

This project is in no way not affiliated, sponsored, or otherwise endorsed by the original Peptides authors. It was developed by Martin Larralde during his PhD project at the European Molecular Biology Laboratory in the Zeller team.

You might also like...
Python Package for DataHerb: create, search, and load datasets.
Python Package for DataHerb: create, search, and load datasets.

The Python Package for DataHerb A DataHerb Core Service to Create and Load Datasets.

wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information
wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information

Python based Wikidata framework for easy dataframe extraction wikirepo is a Python package that provides a framework to easily source and leverage sta

Python package for processing UC module spectral data.

UC Module Python Package How To Install clone repo. cd UC-module pip install . How to Use uc.module.UC(measurment=str, dark=str, reference=str, heade

sportsdataverse python package
sportsdataverse python package

sportsdataverse-py See CHANGELOG.md for details. The goal of sportsdataverse-py is to provide the community with a python package for working with spo

PyEmits, a python package for easy manipulation in time-series data.
PyEmits, a python package for easy manipulation in time-series data.

PyEmits, a python package for easy manipulation in time-series data. Time-series data is very common in real life. Engineering FSI industry (Financial

Retail-Sim is python package to easily create synthetic dataset of retaile store.

Retailer's Sale Data Simulation Retail-Sim is python package to easily create synthetic dataset of retaile store. Simulation Model Simulator consists

A python package which can be pip installed to perform statistics and visualize binomial and gaussian distributions of the dataset

GBiStat package A python package to assist programmers with data analysis. This package could be used to plot : Binomial Distribution of the dataset p

VevestaX is an open source Python package for ML Engineers and Data Scientists.
VevestaX is an open source Python package for ML Engineers and Data Scientists.

VevestaX Track failed and successful experiments as well as features. VevestaX is an open source Python package for ML Engineers and Data Scientists.

nrgpy is the Python package for processing NRG Data Files

nrgpy nrgpy is the Python package for processing NRG Data Files Website and source: https://github.com/nrgpy/nrgpy Documentation: https://nrgpy.github

Comments
  • Per-residue data

    Per-residue data

    It seems that the API can only output single statistics for the entire peptide chain, but I'm interested in statistics for each residue individually. I'm wondering if it might be possible to output an array/list from some of these functions instead of always averaging them as is done now.

    enhancement 
    opened by multimeric 1
  • Hydrophobic moment is inconsistent with R version

    Hydrophobic moment is inconsistent with R version

    Computed hydrophobic moment is not the same as the one computed by R. More specifically, it seems that peptides.py always outputs 0 for the hydrophobic moment when peptide length is shorter than the set window. The returned value matches the value from R when peptide length is equal to or greater than the set window length.

    Example in python:

    >>> import peptides`
    >>> peptides.Peptide("MLK").hydrophobic_moment(window=5, angle=100)
    0.0
    >>> peptides.Peptide("AACQ").hydrophobic_moment(window=5, angle=100)
    0.0
    >>> peptides.Peptide("FGGIQ").hydrophobic_moment(window=5, angle=100)
    0.31847187610377536
    

    Example in R:

    > library(Peptides)
    > hmoment(seq="MLK", window=5, angle=100)
    [1] 0.8099386
    > hmoment(seq="AACQ", window=5, angle=100)
    [1] 0.3152961
    > hmoment(seq="FGGIQ", window=5, angle=100)
    [1] 0.3184719
    

    I think that it can be easily fixed by internally setting the window length to the length of the peptide if the latter is shorter. What I propose:

    --- a/peptides/__init__.py
    +++ b/peptides/__init__.py
    @@ -657,6 +657,7 @@ class Peptide(typing.Sequence[str]):
                   :doi:`10.1073/pnas.81.1.140`. :pmid:`6582470`.
    
             """
    +        window = min(window, len(self))
             scale = tables.HYDROPHOBICITY["Eisenberg"]
             lut = [scale.get(aa, 0.0) for aa in self._CODE1]
             angles = [(angle * i) % 360 for i in range(window)]
    
    bug 
    opened by eotovic 1
  • RuntimeWarning in auto_correlation function()

    RuntimeWarning in auto_correlation function()

    Hi, thank you for creating peptides.py.

    Some hydrophobicity tables together with certain proteins cause a runtime warning for in the function auto_correlation():

    import peptides
    
    for hydro in peptides.tables.HYDROPHOBICITY.keys():
        print(hydro)
        table = peptides.tables.HYDROPHOBICITY[hydro]
        peptides.Peptide('MANTQNISIWWWAR').auto_correlation(table)
    

    Warning (s2 == 0):

    RuntimeWarning: invalid value encountered in double_scalars
      return s1 / s2
    

    The tables concerned are: octanolScale_pH2, interfaceScale_pH2, oiScale_pH2 Some other proteins causing the same warning: ['MSYGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGYGY', 'MFILLIIIGASCFGGGGGCGYGGYGGYAGGYGGYCC', 'MSFGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGGF']

    opened by jhahnfeld 0
Releases(v0.3.1)
  • v0.3.1(Sep 1, 2022)

  • v0.3.0(Sep 1, 2022)

    Added

    • Peptide.linker_preference_profile to build a profile like used in the DomCut method from Suyama & Ohara (2002).
    • Peptide.profile to build a generic per-residue profile from a data table (#3).
    Source code(tar.gz)
    Source code(zip)
  • v0.2.0(Oct 25, 2021)

    Added

    • Peptide.counts method to get the number of occurences of each amino acid in the peptide.
    • Peptide.frequencies to get the frequencies of each amino acid in the peptide.
    • Peptide.pcp_descriptors to compute the PCP descriptors from Mathura & Braun (2001).
    • Peptide.sneath_vectors to compute the descriptors from Sneath (1966).
    • Hydrophilicity descriptors from Barley (2018).
    • Peptide.structural_class to predict the structural class of a protein using one of three reference datasets and one of four distance metrics.

    Changed

    • Peptide.aliphatic_index now supports unknown Leu/Ile residue (code J).
    • Swap order of Peptide.hydrophobic_moment arguments for consistency with profile methods.
    • Some Peptide functions now support vectorized code using numpy if available.
    Source code(tar.gz)
    Source code(zip)
  • v0.1.0(Oct 21, 2021)

Owner
Martin Larralde
PhD candidate in Bioinformatics, passionate about programming, Pythonista, Rustacean. I write poems, and sometimes they are executable.
Martin Larralde
Get mutations in cluster by querying from LAPIS API

Cluster Mutation Script Get mutations appearing within user-defined clusters. Usage Clusters are defined in the clusters dict in main.py: clusters = {

neherlab 1 Oct 22, 2021
Tuplex is a parallel big data processing framework that runs data science pipelines written in Python at the speed of compiled code

Tuplex is a parallel big data processing framework that runs data science pipelines written in Python at the speed of compiled code. Tuplex has similar Python APIs to Apache Spark or Dask, but rather

Tuplex 791 Jan 04, 2023
A real data analysis and modeling project - restaurant inspections

A real data analysis and modeling project - restaurant inspections Jafar Pourbemany 9/27/2021 This project represents data analysis and modeling of re

Jafar Pourbemany 2 Aug 21, 2022
apricot implements submodular optimization for the purpose of selecting subsets of massive data sets to train machine learning models quickly.

Please consider citing the manuscript if you use apricot in your academic work! You can find more thorough documentation here. apricot implements subm

Jacob Schreiber 457 Dec 20, 2022
Import, connect and transform data into Excel

xlwings_query Import, connect and transform data into Excel. Description The concept is to apply data transformations to a main query object. When the

George Karakostas 1 Jan 19, 2022
Python package for analyzing sensor-collected human motion data

Python package for analyzing sensor-collected human motion data

Simon Ho 71 Nov 05, 2022
Single-Cell Analysis in Python. Scales to >1M cells.

Scanpy – Single-Cell Analysis in Python Scanpy is a scalable toolkit for analyzing single-cell gene expression data built jointly with anndata. It inc

Theis Lab 1.4k Jan 05, 2023
Includes all files needed to satisfy hw02 requirements

HW 02 Data Sets Mean Scale Score for Asian and Hispanic Students, Grades 3 - 8 This dataset provides insights into the New York City education system

7 Oct 28, 2021
Additional tools for particle accelerator data analysis and machine information

PyLHC Tools This package is a collection of useful scripts and tools for the Optics Measurements and Corrections group (OMC) at CERN. Documentation Au

PyLHC 3 Apr 13, 2022
MoRecon - A tool for reconstructing missing frames in motion capture data.

MoRecon - A tool for reconstructing missing frames in motion capture data.

Yuki Nishidate 38 Dec 03, 2022
Stock Analysis dashboard Using Streamlit and Python

StDashApp Stock Analysis Dashboard Using Streamlit and Python If you found the content useful and want to support my work, you can buy me a coffee! Th

StreamAlpha 27 Dec 09, 2022
Describing statistical models in Python using symbolic formulas

Patsy is a Python library for describing statistical models (especially linear models, or models that have a linear component) and building design mat

Python for Data 866 Dec 16, 2022
Active Learning demo using two small datasets

ActiveLearningDemo How to run step one put the dataset folder and use command below to split the dataset to the required structure run utils.py For ea

3 Nov 10, 2021
Scraping and analysis of leetcode-compensations page.

Leetcode compensations report Scraping and analysis of leetcode-compensations page.

utsav 96 Jan 01, 2023
📊 Python Flask game that consolidates data from Nasdaq, allowing the user to practice buying and selling stocks.

Web Trader Web Trader is a trading website that consolidates data from Nasdaq, allowing the user to search up the ticker symbol and price of any stock

Paulina Khew 21 Aug 30, 2022
The official pytorch implementation of ViTAE: Vision Transformer Advanced by Exploring Intrinsic Inductive Bias

ViTAE: Vision Transformer Advanced by Exploring Intrinsic Inductive Bias Introduction | Updates | Usage | Results&Pretrained Models | Statement | Intr

104 Nov 27, 2022
Extract Thailand COVID-19 Cluster data from daily briefing pdf.

Thailand COVID-19 Cluster Data Extraction About Extract Clusters from Thailand Daily COVID-19 briefing PDF Download latest data Here. Data will be upd

Noppakorn Jiravaranun 5 Sep 27, 2021
Python script to automate the plotting and analysis of percentage depth dose and dose profile simulations in TOPAS.

topas-create-graphs A script to automatically plot the results of a topas simulation Works for percentage depth dose (pdd) and dose profiles (dp). Dep

Sebastian Schäfer 10 Dec 08, 2022
Mortgage-loan-prediction - Show how to perform advanced Analytics and Machine Learning in Python using a full complement of PyData utilities

Mortgage-loan-prediction - Show how to perform advanced Analytics and Machine Learning in Python using a full complement of PyData utilities. This is aimed at those looking to get into the field of D

Joachim 1 Dec 26, 2021
BErt-like Neurophysiological Data Representation

BENDR BErt-like Neurophysiological Data Representation This repository contains the source code for reproducing, or extending the BERT-like self-super

114 Dec 23, 2022