peptides.py is a pure-Python package to compute common descriptors for protein sequences

Related tags

Data Analysispeptides.py
Overview

peptides.py Stars

Physicochemical properties and indices for amino-acid sequences.

Actions Coverage PyPI Wheel Python Versions Python Implementations License Source Mirror GitHub issues Changelog Downloads

🗺️ Overview

peptides.py is a pure-Python package to compute common descriptors for protein sequences. It is a port of Peptides, the R package written by Daniel Osorio for the same purpose. This library has no external dependency and is available for all modern Python versions (3.6+).

🔧 Installing

Install the peptides package directly from PyPi which hosts universal wheels that can be installed with pip:

$ pip install peptides

💡 Example

Start by creating a Peptide object from a protein sequence:

>>> import peptides
>>> peptide = peptides.Peptide("MLKKRFLGALAVATLLTLSFGTPVMAQSGSAVFTNEGVTPFAISYPGGGT")

Then use the appropriate methods to compute the descriptors you want:

>>> peptide.aliphatic_index()
89.8...
>>> peptide.boman()
-0.2097...
>>> peptide.charge(pH=7.4)
1.99199...
>>> peptide.isoelectric_point()
10.2436...

Methods that return more than one scalar value (for instance, Peptide.blosum_indices) will return a dedicated named tuple:

>>> peptide.ms_whim_scores()
MSWHIMScores(mswhim1=-0.436399..., mswhim2=0.4916..., mswhim3=-0.49200...)

Use the Peptide.descriptors method to get a dictionary with every available descriptor. This makes it very easy to create a pandas.DataFrame with descriptors for several protein sequences:

>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ]) >>> df BLOSUM1 BLOSUM2 BLOSUM3 BLOSUM4 ... Z2 Z3 Z4 Z5 0 0.367000 -0.436000 -0.239 0.014500 ... -0.711000 -0.104500 -1.486500 0.429500 1 -0.697500 -0.372500 -0.493 0.157000 ... -0.307500 -0.627500 -0.450500 0.362000 2 0.479333 -0.001333 0.138 0.228667 ... -0.299333 0.465333 -0.976667 0.023333 [3 rows x 66 columns] "> 
>>> seqs = ["SDKEVDEVDAALSDLEITLE", "ARQQNLFINFCLILIFLLLI", "EGVNDNECEGFFSAR"]
>>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ])
>>> df
    BLOSUM1   BLOSUM2  BLOSUM3   BLOSUM4  ...        Z2        Z3        Z4        Z5
0  0.367000 -0.436000   -0.239  0.014500  ... -0.711000 -0.104500 -1.486500  0.429500
1 -0.697500 -0.372500   -0.493  0.157000  ... -0.307500 -0.627500 -0.450500  0.362000
2  0.479333 -0.001333    0.138  0.228667  ... -0.299333  0.465333 -0.976667  0.023333

[3 rows x 66 columns]

💭 Feedback

⚠️ Issue Tracker

Found a bug ? Have an enhancement request ? Head over to the GitHub issue tracker if you need to report or ask something. If you are filing in on a bug, please include as much information as you can about the issue, and try to recreate the same bug in a simple, easily reproducible situation.

🏗️ Contributing

Contributions are more than welcome! See CONTRIBUTING.md for more details.

⚖️ License

This library is provided under the GNU General Public License v3.0. The original R Peptides package was written by Daniel Osorio, Paola Rondón-Villarreal and Rodrigo Torres, and is licensed under the terms of the GPLv2.

This project is in no way not affiliated, sponsored, or otherwise endorsed by the original Peptides authors. It was developed by Martin Larralde during his PhD project at the European Molecular Biology Laboratory in the Zeller team.

You might also like...
Python Package for DataHerb: create, search, and load datasets.
Python Package for DataHerb: create, search, and load datasets.

The Python Package for DataHerb A DataHerb Core Service to Create and Load Datasets.

DataHerb 4 Feb 11, 2022
wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information
wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information

Python based Wikidata framework for easy dataframe extraction wikirepo is a Python package that provides a framework to easily source and leverage sta

Andrew Tavis McAllister 35 Jan 4, 2023
Python package for processing UC module spectral data.

UC Module Python Package How To Install clone repo. cd UC-module pip install . How to Use uc.module.UC(measurment=str, dark=str, reference=str, heade

Nicolai Haaber Junge 1 Oct 20, 2021
sportsdataverse python package
sportsdataverse python package

sportsdataverse-py See CHANGELOG.md for details. The goal of sportsdataverse-py is to provide the community with a python package for working with spo

Saiem Gilani 37 Dec 27, 2022
PyEmits, a python package for easy manipulation in time-series data.
PyEmits, a python package for easy manipulation in time-series data.

PyEmits, a python package for easy manipulation in time-series data. Time-series data is very common in real life. Engineering FSI industry (Financial

Thompson 5 Sep 23, 2022
Retail-Sim is python package to easily create synthetic dataset of retaile store.

Retailer's Sale Data Simulation Retail-Sim is python package to easily create synthetic dataset of retaile store. Simulation Model Simulator consists

Corca AI 7 Sep 30, 2022
A python package which can be pip installed to perform statistics and visualize binomial and gaussian distributions of the dataset

GBiStat package A python package to assist programmers with data analysis. This package could be used to plot : Binomial Distribution of the dataset p

Rishikesh S 4 Oct 17, 2022
VevestaX is an open source Python package for ML Engineers and Data Scientists.
VevestaX is an open source Python package for ML Engineers and Data Scientists.

VevestaX Track failed and successful experiments as well as features. VevestaX is an open source Python package for ML Engineers and Data Scientists.

Vevesta 24 Dec 14, 2022
nrgpy is the Python package for processing NRG Data Files

nrgpy nrgpy is the Python package for processing NRG Data Files Website and source: https://github.com/nrgpy/nrgpy Documentation: https://nrgpy.github

NRG Tech Services 23 Dec 8, 2022
Comments
  • Per-residue data

    Per-residue data

    It seems that the API can only output single statistics for the entire peptide chain, but I'm interested in statistics for each residue individually. I'm wondering if it might be possible to output an array/list from some of these functions instead of always averaging them as is done now.

    enhancement 
    opened by multimeric 1
  • Hydrophobic moment is inconsistent with R version

    Hydrophobic moment is inconsistent with R version

    Computed hydrophobic moment is not the same as the one computed by R. More specifically, it seems that peptides.py always outputs 0 for the hydrophobic moment when peptide length is shorter than the set window. The returned value matches the value from R when peptide length is equal to or greater than the set window length.

    Example in python:

    >>> import peptides`
>>> peptides.Peptide("MLK").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("AACQ").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("FGGIQ").hydrophobic_moment(window=5, angle=100)
0.31847187610377536

    Example in R:

    > library(Peptides)
> hmoment(seq="MLK", window=5, angle=100)
[1] 0.8099386
> hmoment(seq="AACQ", window=5, angle=100)
[1] 0.3152961
> hmoment(seq="FGGIQ", window=5, angle=100)
[1] 0.3184719

    I think that it can be easily fixed by internally setting the window length to the length of the peptide if the latter is shorter. What I propose:

    --- a/peptides/__init__.py
+++ b/peptides/__init__.py
@@ -657,6 +657,7 @@ class Peptide(typing.Sequence[str]):
               :doi:`10.1073/pnas.81.1.140`. :pmid:`6582470`.

         """
+        window = min(window, len(self))
         scale = tables.HYDROPHOBICITY["Eisenberg"]
         lut = [scale.get(aa, 0.0) for aa in self._CODE1]
         angles = [(angle * i) % 360 for i in range(window)]
    bug 
    opened by eotovic 1
  • RuntimeWarning in auto_correlation function()

    RuntimeWarning in auto_correlation function()

    Hi, thank you for creating peptides.py.

    Some hydrophobicity tables together with certain proteins cause a runtime warning for in the function auto_correlation():

    import peptides

for hydro in peptides.tables.HYDROPHOBICITY.keys():
    print(hydro)
    table = peptides.tables.HYDROPHOBICITY[hydro]
    peptides.Peptide('MANTQNISIWWWAR').auto_correlation(table)

    Warning (s2 == 0):

    RuntimeWarning: invalid value encountered in double_scalars
  return s1 / s2

    The tables concerned are: octanolScale_pH2, interfaceScale_pH2, oiScale_pH2 Some other proteins causing the same warning: ['MSYGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGYGY', 'MFILLIIIGASCFGGGGGCGYGGYGGYAGGYGGYCC', 'MSFGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGGF']

    opened by jhahnfeld 0
Releases(v0.3.1)

  • v0.3.1(Sep 1, 2022)

  • v0.3.0(Sep 1, 2022)

    Added

    • Peptide.linker_preference_profile to build a profile like used in the DomCut method from Suyama & Ohara (2002).
    • Peptide.profile to build a generic per-residue profile from a data table (#3).
    Source code(tar.gz)
    Source code(zip)

  • v0.2.0(Oct 25, 2021)

    Added

    • Peptide.counts method to get the number of occurences of each amino acid in the peptide.
    • Peptide.frequencies to get the frequencies of each amino acid in the peptide.
    • Peptide.pcp_descriptors to compute the PCP descriptors from Mathura & Braun (2001).
    • Peptide.sneath_vectors to compute the descriptors from Sneath (1966).
    • Hydrophilicity descriptors from Barley (2018).
    • Peptide.structural_class to predict the structural class of a protein using one of three reference datasets and one of four distance metrics.

    Changed

    • Peptide.aliphatic_index now supports unknown Leu/Ile residue (code J).
    • Swap order of Peptide.hydrophobic_moment arguments for consistency with profile methods.
    • Some Peptide functions now support vectorized code using numpy if available.
    Source code(tar.gz)
    Source code(zip)

  • v0.1.0(Oct 21, 2021)

Owner
Martin Larralde
PhD candidate in Bioinformatics, passionate about programming, Pythonista, Rustacean. I write poems, and sometimes they are executable.
Martin Larralde
GitHub Repository
signac-flow - manage workflows with signac

signac-flow - manage workflows with signac The signac framework helps users manage and scale file-based workflows, facilitating data reuse, sharing, a

Glotzer Group 44 Oct 14, 2022
Finding project directories in Python (data science) projects, just like there R rprojroot and here packages

Find relative paths from a project root directory Finding project directories in Python (data science) projects, just like there R here and rprojroot

Daniel Chen 102 Nov 16, 2022
A data analysis using python and pandas to showcase trends in school performance.

A data analysis using python and pandas to showcase trends in school performance. A data analysis to showcase trends in school performance using Panda

Jimmy Faccioli 0 Sep 07, 2021
Larch: Applications and Python Library for Data Analysis of X-ray Absorption Spectroscopy (XAS, XANES, XAFS, EXAFS), X-ray Fluorescence (XRF) Spectroscopy and Imaging

Larch: Data Analysis Tools for X-ray Spectroscopy and More Documentation: http://xraypy.github.io/xraylarch Code: http://github.com/xraypy/xraylarch L

xraypy 95 Dec 13, 2022
API>local_db>AWS_RDS - Disclaimer! All data used is for educational purposes only.

APIlocal_dbAWS_RDS Disclaimer! All data used is for educational purposes only. ETL pipeline diagram. Aim of project By creating a fully working pipe

0 Apr 25, 2022
The lastest all in one bombing tool coded in python uses tbomb api

BaapG-Attack is a python3 based script which is officially made for linux based distro . It is inbuit mass bomber with sms, mail, calls and many more bombing

59 Dec 25, 2022
scikit-survival is a Python module for survival analysis built on top of scikit-learn.

scikit-survival scikit-survival is a Python module for survival analysis built on top of scikit-learn. It allows doing survival analysis while utilizi

Sebastian Pölsterl 876 Jan 04, 2023
PyEmits, a python package for easy manipulation in time-series data.

PyEmits, a python package for easy manipulation in time-series data. Time-series data is very common in real life. Engineering FSI industry (Financial

Thompson 5 Sep 23, 2022
ToeholdTools is a Python package and desktop app designed to facilitate analyzing and designing toehold switches, created as part of the 2021 iGEM competition.

ToeholdTools Category Status Repository Package Build Quality A library for the analysis of toehold switch riboregulators created by the iGEM team Cit

0 Dec 01, 2021
The micro-framework to create dataframes from functions.

The micro-framework to create dataframes from functions.

Stitch Fix Technology 762 Jan 07, 2023
ForecastGA is a Python tool to forecast Google Analytics data using several popular time series models.

ForecastGA is a tool that combines a couple of popular libraries, Atspy and googleanalytics, with a few enhancements.

JR Oakes 36 Jan 03, 2023
Stitch together Nanopore tiled amplicon data without polishing a reference

Stitch together Nanopore tiled amplicon data using a reference guided approach Tiled amplicon data, like those produced from primers designed with pri

Amanda Warr 14 Aug 30, 2022
Picka: A Python module for data generation and randomization.

Picka: A Python module for data generation and randomization. Author: Anthony Long Version: 1.0.1 - Fixed the broken image stuff. Whoops What is Picka

Anthony 108 Nov 30, 2021
Python-based Space Physics Environment Data Analysis Software

pySPEDAS pySPEDAS is an implementation of the SPEDAS framework for Python. The Space Physics Environment Data Analysis Software (SPEDAS) framework is

SPEDAS 98 Dec 22, 2022
Analysis scripts for QG equations

qg-edgeofchaos Analysis scripts for QG equations FIle/Folder Structure eigensolvers.py - Spectral and finite-difference solvers for Rossby wave eigenf

Norman Cao 2 Sep 27, 2022
Exploratory Data Analysis for Employee Retention Dataset

Exploratory Data Analysis for Employee Retention Dataset Employee turn-over is a very costly problem for companies. The cost of replacing an employee

kana sudheer reddy 2 Oct 01, 2021
A set of procedures that can realize covid19 virus detection based on blood.

A set of procedures that can realize covid19 virus detection based on blood.

Nuyoah-xlh 3 Mar 07, 2022
Vectorizers for a range of different data types

Vectorizers for a range of different data types

Tutte Institute for Mathematics and Computing 69 Dec 29, 2022
Evidence enables analysts to deliver a polished business intelligence system using SQL and markdown.

Evidence enables analysts to deliver a polished business intelligence system using SQL and markdown

915 Dec 26, 2022
A Python Tools to imaging the shallow seismic structure

ShallowSeismicImaging Tools to imaging the shallow seismic structure, above 10 km, based on the ZH ratio measured from the ambient seismic noise, and

Xiao Xiao 9 Aug 09, 2022